login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG18985
Organism Anopheles gambiae str. PEST
Gene Name agEG18985
Product NADH-UBIQUINONE OXIDOREDUCTASE 18 KDA SUBUNIT (NUYM) (By similarity)
GENE MAP
Chromosome 2L
Celera Gene agCG52482
Citogenetic Map 27A
Gene Map
Comment This record is derived from the following: gb|AAAB01008807.1 gb|BM628145 5', mRNA sequence gb|BM644998 5', mRNA sequence The following contributed to reference sequence development: bases 1..3070 - AAAB01008807.1 7095454..7092385
PRODUCT
Function Function: Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0005624
Cellular component: membrane fraction.
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000018985
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008807.1
Sequence Location 7095454..7092385
Sequence Lenght 3070bp
Relative Gene location 1030 .. 2072
CDS
CDS Location 1092 .. 1963
Sequence Lenght 183aa
Translation MSLFLRSVARAGATQWMRASLSTSSIAFKDPKAQKEAPILDASVVLADAEERARDHLPTI
TVPTKVDISPITGVPEEHVKERRVRIFMPAKNAMQSGTDNIHHWSIEFDNRERWENPLMG
WSSTGDPLSNMRVDFTSADEAIAHCEKNGWRWFVDKQEVQKKPRVKNYGINFSWNKRTRV
STK
mRNA
mRNA Location 1030 .. 2072
5'UTR Location 1030..1091
3'UTR Location 1964..2072
Exon 1030..1138,1308..1455,1533..1708,1783..2072
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
GGAAAATATCTGGCCGCAGCAAAATCGCACCGTGTCTGCGTACGGGAAAATCTAAAGCAA
AA
ATGAGCCTATTCCTGCGTTCAGTGGCGAGAGCTGGTGCTACGCAATGGATGCGTGCAT
CACTCTCGACGTCATCGATCGCGTTCAAGGATCCGAAGGCACAAAAGGAAGCCCCGATAC
TGGACGCTAGCGTTGTTCTCGCCGATGCAGAGGAGCGTGCCCGTGACCACCTTCCCACGA
TCACGGTGCCGACCAAG
GTCGATATTAGCCCTATTACTGGCGTGCCGGAGGAGCACGTGA
AGGAGCGCCGCGTGCGCATCTTCATGCCGGCCAAGAACGCGATGCAAAGCGGTACGGACA
ACATCCACCACTGGAGCATCGAGTTCGATAACCGCGAGCGCTGGGAGAACCCACTGATGG
GATGGTCCTCAAC
CGGTGATCCATTGTCGAACATGCGCGTCGACTTCACCAGCGCCGACG
AGGCGATCGCCCACTGCGAAAAGAACGGCTGGAGATGGTTCGTGGACAAGCAGGAGGTGC
AGAAGAAGCCGCGCGTCAAGAACTACGGCATCAACTTTAGCTGGAACAAGCGTACCCGCG
TGTCGACCAAGTGA
GAAGGTGTTTTAAACAAAAGAAGAAAAAGCGTGGACATCAAACAAA
CCGGTGCCGTTGTTAGCTATCGTTGTAAATAAGAGACACCTCCTTAAAATTCGTGTCAAT
GAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TAGGCAAATAATTTCGTCTCAAATTTGAGTTGGAACATTTTATTCTGGTGCATTCTATTT
CGCTATAAAGTACTGTTGCGGCCGAGGGGCTCCGCCGGGCGAAGGTTCCGGCTCCTACGG
CTACAACGGGGAATTCTCCAAGCCTTTCAGCTAGTGCTCCTCGCTACCTCGGGAGTCTAT
GCAACAGAAAGGGGGATCGTTCCTTGAGATTCGGATTATTTCGGATGTTCTGAAATGAAG
CTCTTAACACTTTGGCTTATCGTTCGAATCTGATTTGGCTCCAGCTTGAGCCGCCTTTAT
ATACCAAAAAATTCACAAATTTTCTGCCCGATACTAACCCAAAATTCTACGCCTTTCCTC
CCACTCCCATTCCCGTTTGTCCCCAACTCCCATCGCGCTCCCGGTTTCCATTGTCACTCC
CGGCGACATCTGTTTGCACTGGCGATTCCAGAAATTCCGCATCGATCAATCCATCGAGCA
ATCCTTTGTGTAGACGGTACCGGTGCTGCGCGTGCTGGTAGCGACGTTCATCGTGGGGGG
TACGGCTGGCGTTTCGTGGAAATTCACCGATCTTGTGTCTTTTCACTTTTTATTTTTTAT
TCTGCATGCACTTCGCACGCAACAAGTACCGAGCCTTTTCATGGGCTGTCTTAATATCCG
TGTTGTTCAAAAATCCCTAGGAGGAGATATGAAAAACAATCCATTGACAGATATCCAAAC
GAAAACCAAACAAAAATTCATATTTTTTTTTTCAAAAACAATGTTAAAAATACTTGGAAT
TCAAAAAAATCACTATGAGTATGGACAAACGGTATTCTACTGAATTTTATGCATGAAATT
ATCTTTTTCAGACTCTCAAATTCTGTTCATTTTTTTAATTTATCTTCTGCTTCAACTTCT
TTACCCGTGTAGACACTGCTGCAGTAAAACACGATCCCTCTACTGTACTGACAGCATCCT
CCCCGATTCCACCTGTCACCTCAACTGACAGTTTGGTTTCTGTTTTGGTTTTTTCCACTC
GCTGTCAAAGGAAAATATCTGGCCGCAGCAAAATCGCACCGTGTCTGCGTACGGGAAAAT
CTAAAGCAAAA
ATGAGCCTATTCCTGCGTTCAGTGGCGAGAGCTGGTGCTACGCAATGGT
AAGCTTCTGCCGAAAGTGCCAAAACACAAACTGCCTTGTGTTGATTGCAATCATCAACAA
GAACGAACTTCCCTTCATGCCACTTGCTCCTCCCGGCTGGATGGATGGTTGTGTAATCGA
AATTGTTTTGTGGCAACTGATATCCTTTTTCTCTTCCCCTCCGCAAGGATGCGTGCATCA
CTCTCGACGTCATCGATCGCGTTCAAGGATCCGAAGGCACAAAAGGAAGCCCCGATACTG
GACGCTAGCGTTGTTCTCGCCGATGCAGAGGAGCGTGCCCGTGACCACCTTCCCACGATC
ACGGTGCCGACCAAG
GTTAGTTGATAGTTGTTGTACGGTGCAAAGAGGTAAAGCAAATCC
TCAACAATACCCATGTTTGCCTTCACTTCCAGGTCGATATTAGCCCTATTACTGGCGTGC
CGGAGGAGCACGTGAAGGAGCGCCGCGTGCGCATCTTCATGCCGGCCAAGAACGCGATGC
AAAGCGGTACGGACAACATCCACCACTGGAGCATCGAGTTCGATAACCGCGAGCGCTGGG
AGAACCCACTGATGGGATGGTCCTCAAC
GTGAGTGTTTGCGTTTGCGGGGGACGTTACGA
AAGTGCATTTTGTTGTAATTTTCACCTTTCACCACATTCTAGCGGTGATCCATTGTCGAA
CATGCGCGTCGACTTCACCAGCGCCGACGAGGCGATCGCCCACTGCGAAAAGAACGGCTG
GAGATGGTTCGTGGACAAGCAGGAGGTGCAGAAGAAGCCGCGCGTCAAGAACTACGGCAT
CAACTTTAGCTGGAACAAGCGTACCCGCGTGTCGACCAAGTGA
GAAGGTGTTTTAAACAA
AAGAAGAAAAAGCGTGGACATCAAACAAACCGGTGCCGTTGTTAGCTATCGTTGTAAATA
AGAGACACCTCCTTAAAATTCGTGTCAATGAA
CTAACGTGTTTTCTCCGTCCTAGTTTGC
CGATCGTTTCTTTCCCCACACAGGGGGATCACTGTGCGAACGGTCAAAGCCTTCTTTTCG
GTTTGGGAACGAAATGTTCCCTTCCTCGTCAAGTTTATTCAAGTTCATCAAAGCTTACGG
GCTAAAACGGTTCAACGGTTTAATTCGAACAGGCACTGTGCGCCATTGAGTTCAACTTTA
AGCTGATTTCACGATCGCCGCATACAACAACAAAAAAAGTCCAACTAACGGTTACTTTAA
TTCAAAATGCTCCTACTAAAATGGACGGAAAAAAGTACAAAAAAAGGCGCTTGAGGTAAC
CACCAAATAATCCTAATAATTCTTCGAATATCCCGATGGACCACCATCCATCTGTAGCTG
TTCCAGCTGTAGCTGCTTTCGGATCGCCCCGAGCTGCGTCAACACACGCGTTGATCCCTT
TTCATTCACTTTTGTCCGTTCAACGGCGGGTACCTTTTTGGAAAAAGAAAAGCTGTTGTT
TAAGAGTTCCTTTTCTACCCCTTTTACTCCACTTCTTCTTACCTCCCATTTCTTCTCCAT
CAGCTTCAGGGCGTCACTTTTCAGATTGTCCGGTCGATCACTTACGTACACTTTCGGGGG
CGAAAGCGATGGAAGCAGTGGTCCGGTTTTGTTCCCCTTCACACGATCATTGCTGTGCTG
CTCCTGCTCACGATGATTATGGTGGTGTTGTTGATGATGATGGGAAGAATGATGATGATG
ATGATGGTAATCGTTGTGCTGTTGCCCATTACTGTTGCCCTTTCTACCATTGCCACGCTT
CATCCAAAGCGTGTTGTAGTGTCGCACGTACTTGGCAATCCGGTCATCCATCAGATCGTC
CCCGACGGTGGCGGACGAAGTTTCCCCGTCCCCATCGGACAACGGTGGGCTGTCGGGTGG
AGCGTATCGGGACGGTCCCGCCCCTCCCGATCGCAGCTTATTGTCCACAAACACTTCCCC
GTTGCGGATG
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004