login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG12203_1
Organism Drosophila pseudoobscura
Gene Name Dpse\CG12203_1
Product NADH-UBIQUINONE OXIDOREDUCTASE 18 KDA SUBUNIT (NUYM) (By similarity)
GENE MAP
Chromosome pseudoXL-melX
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig1045_Contig3832 The following contributed to reference sequence development: bases 1..2700 - Contig1045_Contig3832 1031682..1034381
PRODUCT
Function Function: Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0005624
Cellular component: membrane fraction.
SwissProt AC  --
HGSC (Dpseudoobscura) Contig1045_Contig3832
View Sequence REFERENCE SEQUENCE
Contig Contig1045_Contig3832
Sequence Location 1031682..1034381
Sequence Lenght 2700bp
Relative Gene location 1025 .. 1696
CDS
CDS Location 1025 .. 1696
Sequence Lenght 181aa
Translation MSLIRQVMCRTTSFQLLNVNKITTSRCASTKDTAPLDLKTALARPEELEQRNKLSGKITV
PTAVNLGPISGVPGEQLKDRRVRIHIPPKNAMQSGTDNINTWQIEFDNRERWENPLMGWA
SSGDPLSNLNVQFGTKDEAITYCERNGWRWYIDGEEKPKKERVKNYGINFSWNKRTRVST
K
mRNA
mRNA Location 1025 .. 1696
5'UTR Location  --
3'UTR Location  --
Exon 1025..1071,1138..1455,1516..1696
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGTCGCTTATACGCCAAGTAATGTGCAGGACTACATCCTTTCAGCTATTAAACGTCAAT
AAAATCACAACTTCCCGCTGCGCTTCTACCAAAGATACTGCTCCATTGGATCTAAAAACG
GCCTTGGCCCGTCCTGAGGAGTTGGAACAGCGCAACAAATTGAGCGGAAAGATCACCGTG
CCCACTGCCGTAAATCTTGGTCCCATTTCCGGAGTGCCCGGGGAGCAGCTGAAGGACCGT
CGTGTGCGCATTCACATACCACCTAAGAATGCAATGCAAAGCGGCACAGACAACATTAAC
ACTTGGCAGATTGAGTTCGACAATCGGGAGCGATGGGAAAACCCTCTAATGGGCTGGGCC
TCTTC
TGGCGACCCGCTCTCCAATTTAAATGTGCAGTTCGGAACTAAAGACGAAGCCATC
ACCTACTGTGAACGCAACGGCTGGCGTTGGTATATCGATGGCGAAGAGAAGCCCAAGAAG
GAGCGCGTCAAGAACTACGGGATCAACTTTTCCTGGAACAAGCGCACACGTGTCTCCACC
AAGTAG
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
AGCCTCGCGGGCAGAGCGGAAGCGGCGGCTTCTTTGCTGATTCATTTTGGCCCGCGGGGC
AACACCATCCACAGCCAGGAAAAAAAGTTTCTGTGGCTTAATCAGGTAGAACAGCTTGTC
CACATAGTTGAAAATGTCCTGAAATATCTGCTGCTCCTCCAAGTGAAAGTGTATGTTGTT
GTCATCCGGATGGGAGCAGTTGTGGACGATGCCATTCATGTCCAGGTATAGGTTGTCGAA
CTCAGGGATCTGTTAGCATGAAAAGGAAAGGAAACAGCTGATGACGTGGTTGGGGGGACA
GCGTTGACCCATAACTTACGCTATGCTCGCGCGCCAATTCGCTCAGGCACGGATACCTTT
CGCTGATATAGCGGAAAAACTTCGGAACACCCATATCAACTCAAATAAAATTTTTGTTTG
TTACTAGGAAAATCACAATCAGATTAGAATTATAATTCTACGCAATGTCGATGTCCTTGG
TCACTGTCAATTTTGCAAGGAGTCAGTGATGGTCGGTGTGACCGTGGACTTATCGGTCAA
ACATACCGTCCGACCCTCAGAAATATACCAAAATACACCGTCTAATTTTAAAAATACACC
GTAAATATACTGACGAATTCAAGTTCTATATTCCTTGATTTTTATATTCCTGCCCACATC
ATTTTATCGAATTATTTTAAATACTTGACTTTGTCTCAATTTTGGTTCCTCAAAAACAAT
ATAGCGTCTCGTATGATGAAAAACCGAACGCAGCCCACTTAAGCCCCCTCTAATAAAATA
GTTCAACTATTTTAGGTAAATGGCGGAAAATATTAGCGATTGTAAAGTCTTTTTGAAGAT
TCATGCCATATTTCCTCTGAACTTAAGAAAAAAACCACCATATCTTTCACATGAAAAAAA
AAACGATTAATTGGAACTGTTTTAGTTCGTTCACTGCAGTGAACGTTCGTTCGTTCATGA
GCGACCACACTAAACAAAACCGATTGATTTCTGTTCCAAATTTTACGTAATTCTACCTGC
GAAAATGTCGCTTATACGCCAAGTAATGTGCAGGACTACATCCTTTCAGCTGTAAGTGTC
AATCCTCGCACATCTTAGAAATGCTAACCATCCATTCGTGTTTTGGTTGGTCTGTAGATT
AAACGTCAATAAAATCACAACTTCCCGCTGCGCTTCTACCAAAGATACTGCTCCATTGGA
TCTAAAAACGGCCTTGGCCCGTCCTGAGGAGTTGGAACAGCGCAACAAATTGAGCGGAAA
GATCACCGTGCCCACTGCCGTAAATCTTGGTCCCATTTCCGGAGTGCCCGGGGAGCAGCT
GAAGGACCGTCGTGTGCGCATTCACATACCACCTAAGAATGCAATGCAAAGCGGCACAGA
CAACATTAACACTTGGCAGATTGAGTTCGACAATCGGGAGCGATGGGAAAACCCTCTAAT
GGGCTGGGCCTCTTC
GTAAGTATCGCGATTCGACTTTTAGTGGCCTAGTACACATTTGTC
TTGCTTTTTCCACAGTGGCGACCCGCTCTCCAATTTAAATGTGCAGTTCGGAACTAAAGA
CGAAGCCATCACCTACTGTGAACGCAACGGCTGGCGTTGGTATATCGATGGCGAAGAGAA
GCCCAAGAAGGAGCGCGTCAAGAACTACGGGATCAACTTTTCCTGGAACAAGCGCACACG
TGTCTCCACCAAGTAG
ATTGGGCAGTTTAATCACTCGATGAACTATCACTGTTGAAATAC
ATGAACAAAAAAATCACGCCTTTATGTCCTTGGGCTTCTCCATTGAATGATTTGCACAAT
TAAGCTTGAAGGGCCAAAGGATGTACGCGTAGGGAAGAGACATTGGGCGCGTTCACCAGC
ACAACTGGCTGAGTGATGGATTTCGGAATGTGGAGCGTACTATTATTACCGGCACTGTCG
TATGCAATCCATCAGTGTGCGCTGAGCAAGTTGCGCTGGTTTCACCAGTACACGAAACCT
AATTCAGGGCTGAGCTTCCTAGTTGAACACTATTCAAAATCCGTGCTGCGATGAGTAATG
TAGCCGTCGGTGATCCAAAAGCAGCTAGCTCTGAAGCCTGACTCCTCTGCGACTTTGCTG
GTTTACCGCTCAATCATTCTTCTGCCGGCCACAACACACGCTCCTTTTAAGCGAAACTGC
TAGTCATCAGTCACAATCACCGTTAGTTTACAGTAAATTCCAGTGGTAAACAATGCATGT
TTGTGCATGCATATATTTACAATCCGTACATTTCAGTTATACATATATGAAAAACATCGG
AGTGTTGAGTTTAAGCCATGAATTTGTCAGTGACATTACTAAAACTTAGGGTTAACTCCA
GAAGAGAACAGTAAACGCCATCAACAGGCAAGCGGCACCGACCCAGGGCGACTTTCGCTC
ACCTATGCGCGCCAGCTTCCAAAACGTGCCAAGCAGGCTGAAATGAAGAGATATATTTGG
TAATTGAACGGAAAGAGGTGGCTTGATGGGTCCTACCCAGTCTTTTTCCTGTCGATGATG
CTGGGGAACATAGACCGCAAATAAGCACAGGTGCAGATCAGGAGCAGGATGACGGACAGC
AAGCTTTGGAAATTAAACAGGGCACTCTGGGGAAGACAAAGATTTTAGGATTACTGTTTT
TTACGTAGGACTATGGGAATCCAAACCATTGCACAAATTTATGGGCTATCTATGGTTAAC
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004