login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG13539
Organism Anopheles gambiae str. PEST
Gene Name agEG13539
Product Succinate dehydrogenase [ubiquinone] iron-sulfur protein (DHSB) (By similarity)
GENE MAP
Chromosome 2L
Celera Gene agCG55151
Citogenetic Map 27D
Gene Map
Comment This record is derived from the following: gb|AAAB01008807.1 gb|BM578378.1 5', mRNA sequence gb|BM655741.1 5', mRNA sequence The following contributed to reference sequence development: bases 1..3999 - AAAB01008807.1 4108347..4104349
PRODUCT
Function Unknown
Subcellular Location Mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex II: Succinate dehydrogenase
EXTERNAL RESOURCES
GO GO:0005739
Cellular component: mitochondrion.
GO:0009060
Biological process: aerobic respiration.
GO:0006099
Biological process: tricarboxylic acid cycle.
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000013539
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008807.1
Sequence Location 4108347..4104349
Sequence Lenght 3999bp
Relative Gene location 958 .. 3297
CDS
CDS Location 1115 .. 3008
Sequence Lenght 290aa
Translation MAVIAADLKLLLACRGTFGQIRNIHLAAANNAAAKKVKKFQIYRWNPDKPEEKPYNQTYE
VDLSACGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDADNL
DKPTKIYPLPHMYVVKDLVPDMNNFYNQYRSIQPWLQRKNESTEKKGDAQYLQSVDDRAK
LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWIIDSRDESTAARLDKLKDPFS
VYRCHTIMNCTRTCPKGLNPGKAIAEIKKLLSGIAKKDAPGLETAALHNK
mRNA
mRNA Location 958 .. 3297
5'UTR Location 958..1114
3'UTR Location 3009..3297
Exon 958..1174,1980..2090,2175..2479,2612..3297
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
GCAACGCGCACATATCGGCCAGGACCTCACGCCTCGTCGCTAGCCAGCGGAAAATCGACT
CGCTCGTGGGAATCAAAACAATCTTCGAACGTTCGTCCGAAGCCTAGTGTGTTGTTTCCT
TGTGTGTGGTGTTGTTGGCGAAAAAGTAAACCTCGCA
ATGGCCGTGATTGCTGCGGATCT
CAAGTTGCTGCTGGCCTGCCGTGGCACCTTTGGCCAG
ATCAGAAACATTCACCTCGCGGC
TGCCAACAATGCCGCGGCCAAGAAAGTTAAAAAGTTCCAGATCTACCGCTGGAATCCGGA
TAAGCCGGAGGAGAAACCGTACAACCAG
ACGTACGAAGTCGACCTGAGTGCCTGCGGCCC
GATGGTGCTGGACGCGCTGATCAAGATCAAGAACGAAATGGACCCCACGCTGACGTTCCG
CCGGTCGTGCCGCGAAGGCATCTGTGGCTCGTGCGCCATGAACATTGGCGGCACGAACAC
GCTCGCCTGCATCAGCAAGATCGATGCGGACAACTTGGACAAACCGACCAAGATCTACCC
TCTACCGCACATGTACGTGGTAAAGGATCTGGTGCCGGACATGAACAACTTCTACAACCA
GTACCGCTCGATTCAGCCCTGGCTACAGCGCAA
GAACGAAAGCACCGAAAAGAAGGGCGA
TGCCCAGTACCTCCAGTCGGTGGACGATCGCGCCAAGCTGGACGGTCTGTACGAGTGCAT
TCTGTGTGCGTGCTGCTCCACGTCCTGCCCGTCCTACTGGTGGAACGGCGACAAGTACCT
TGGGCCGGCGGTGCTGATGCAGGCGTACCGTTGGATTATCGATTCGCGCGATGAAAGCAC
TGCCGCCCGGTTGGACAAGCTGAAGGATCCGTTCAGCGTGTACCGGTGCCACACGATCAT
GAACTGCACGCGCACCTGCCCGAAGGGGCTGAACCCGGGCAAGGCGATCGCGGAGATCAA
GAAGCTGCTGTCGGGCATTGCCAAGAAGGACGCACCCGGTCTGGAGACGGCCGCCCTGCA
CAATAAGTAA
AGTGTTCGAAGGCCCCGGGGATAGCAAGACCTCCTAGTGTATGGCTGCAC
TGCCACCCAACGCGCTGCCCGCCCCGCTCCCAGTGCAAATGGCTTTAGTATGTGAGATGG
CACGGAACACGGCCAAAACGGCAAAGTAGATCACCAACAACCAGAACAAAAGCGGTGCGT
GACTGTGTGTGTGAGTGTGTGTGTGTGCATGTGCGAGAGTGTACGAGGAATTTGTTGAGT
AGAAAGGAAAGTATTTCGATACCAAAAAATGTCGCGAAAAAGAGGCACTAGAAACAAGC
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GCTCCGATGGAATTGTATCTGGAGTCTCTCTGTCTCTCTCTCTCTCGAAGTCTGTGGTAG
ATTGTTCTTATAAAAAAAGGAATTGGTAGCGAGATGAAACAACTAGAACTAACAACTAAC
ACCGTTCTGCGATGGTGAAGAATGGCCAAACTTTTTTCATATTCAGAAACTAGGCTAACA
AAACTATTGACTAATGCATTTTGTTTTTTTTTTGTGCTGCTATCGGATAGAGAGAAAAAG
AGAACGAGAGTTAAGAGATGATACTGGAGGCAGCTGTCAAAAAGCTAATCAATGACCCCT
TTAAAACCATCTATTTCTGTACCATACATAGTAGCTATGAATTTAACAATTTAAAGATTC
TATCGGTAAAAAATGCCATTCTAACTCTTCAACACTGCTCGTGTAACGGTGCGAGGACAT
AACAAGCTAGAGAACATTGAAAAAAACACACACATACCGAAACAGTAGCAAGTAGAAAAC
ATTACTCTATAACGGTAGATGGGAAATAAAAACTGTCCAGCACTGTACGAGCGTCGCATG
CCCACGTGCCCAAACGCGTGTTGAGTGAATCGCAAAGACTAGTAGAGATACATGGAAGCT
AGTTGGACAGGAAAGTAATAAAGTATTTTCAAATATTTTCTCTTTTCACGTGACCTGTGT
ATTGATTTGTAGTGCTGTAGTCCGAAAATGTTTACTTTTTATGCGTAAAATTGGCAGCAT
GCCAACGAGCGACCACCGACCGGTACACTTTTGAACGTTCAATTTGAAATGCGAGCTTTC
GTCCAAAGCTTTCGGTGGCAAAGCTTCCCCTTTCAACGACACAAACGTCACTCGGCGCCC
CCGCCTCTGAACGAAGCAACTGTCAAGCAGGCTGAGCGCTGAACGAAAACACATTAAAAA
AAATCGCGATTTGTTTCATTTTTTTCTTTGCTCGTCTCTCTTATTTCACAAATTTGGGCA
ACGCGCACATATCGGCCAGGACCTCACGCCTCGTCGCTAGCCAGCGGAAAATCGACTCGC
TCGTGGGAATCAAAACAATCTTCGAACGTTCGTCCGAAGCCTAGTGTGTTGTTTCCTTGT
GTGTGGTGTTGTTGGCGAAAAAGTAAACCTCGCA
ATGGCCGTGATTGCTGCGGATCTCAA
GTTGCTGCTGGCCTGCCGTGGCACCTTTGGCCAG
GTAATACGAACGCGCGGTGGAGCTGT
GTTGGCAAACTCTTTTCCTTCCAGAACAATCCAGCGCGCGTGCTGGGCGCCACCTTTCCG
GAAGTATTGAGATGTGACTTCCTCGCGAGGAAAAGCTTGCCATGCTGACGCACGAAACAA
AACCCATCATCCCATGGTACATTGTCTCGAGTTATGGTAGAATGGGCATTATATAACTTC
TGCCGTGCAAAAAGTGATAATTTCGTAAAACCACGAGATGGGTTGTTAATGAGCCCGGGT
TGATGGGGGAGGGGAAATCGATCCAGAAGGCCAGCCCAATCTGTCGACCCCCCGCTTTCC
AGTGGGCAAACCATAGACACAACCTTGTGCAATCTTATCGCCAGGGCCCCTGGAGAGGCG
CCTATCGATAGCCCGGGGCAGGGTGAAAGGTGGTCACGGGTCAACACGTACCACGGCTAA
TTGCTCGGGCTGCCGCTCGTGTGGAATCTGGAATGCGTTGAACCCGTTTTTTTGCGCGTT
TTGCTCCTTCTGCTCTTTCGCCAATCCACGGTTTGGCCTGCAAATTATCACGATTGGCAC
GCGGCTCTTGTGGCGCGGCGAGGAGAGTGTGACGCAAATTAATTCAGTAAATTTTATTGC
ATTGCTCGCCAATTGAATTTGCCCCCCGTCTGTCACCTGCTTCGCGTATGTGCTTGTGTG
TGGGTCAACAAGGCCAACGAGAACAAGTTAGCACTGGAATCGGTTTCCAGCTCATTCTTT
CGTGGCGGTGACATCGTTTAACGCTTTTTTCTCGTTTTTTTTTTTAATTTTGCTTTCAGA
TCAGAAACATTCACCTCGCGGCTGCCAACAATGCCGCGGCCAAGAAAGTTAAAAAGTTCC
AGATCTACCGCTGGAATCCGGATAAGCCGGAGGAGAAACCGTACAACCAG
GTAAGGGCGT
GCGAGAGTTATGCAATGATGAAGTAACTGTTTTAAAATATTAAATTCTTTTTTCTTTTAC
ACTTCCAAAACCAGACGTACGAAGTCGACCTGAGTGCCTGCGGCCCGATGGTGCTGGACG
CGCTGATCAAGATCAAGAACGAAATGGACCCCACGCTGACGTTCCGCCGGTCGTGCCGCG
AAGGCATCTGTGGCTCGTGCGCCATGAACATTGGCGGCACGAACACGCTCGCCTGCATCA
GCAAGATCGATGCGGACAACTTGGACAAACCGACCAAGATCTACCCTCTACCGCACATGT
ACGTGGTAAAGGATCTGGTGCCGGACATGAACAACTTCTACAACCAGTACCGCTCGATTC
AGCCCTGGCTACAGCGCAA
GTAAGTGTGGTGTGGTGTTGCTAACCGTGCCTACTAGATTT
GGCATGCGCCGCCACGGCTTATCAGCACCGGCTGGTTGCTTCGTTGGTAACTGACCTGAC
TCATCCAAATGCTCCCCCCTATCTGTTGCAGGAACGAAAGCACCGAAAAGAAGGGCGATG
CCCAGTACCTCCAGTCGGTGGACGATCGCGCCAAGCTGGACGGTCTGTACGAGTGCATTC
TGTGTGCGTGCTGCTCCACGTCCTGCCCGTCCTACTGGTGGAACGGCGACAAGTACCTTG
GGCCGGCGGTGCTGATGCAGGCGTACCGTTGGATTATCGATTCGCGCGATGAAAGCACTG
CCGCCCGGTTGGACAAGCTGAAGGATCCGTTCAGCGTGTACCGGTGCCACACGATCATGA
ACTGCACGCGCACCTGCCCGAAGGGGCTGAACCCGGGCAAGGCGATCGCGGAGATCAAGA
AGCTGCTGTCGGGCATTGCCAAGAAGGACGCACCCGGTCTGGAGACGGCCGCCCTGCACA
ATAAGTAA
AGTGTTCGAAGGCCCCGGGGATAGCAAGACCTCCTAGTGTATGGCTGCACTG
CCACCCAACGCGCTGCCCGCCCCGCTCCCAGTGCAAATGGCTTTAGTATGTGAGATGGCA
CGGAACACGGCCAAAACGGCAAAGTAGATCACCAACAACCAGAACAAAAGCGGTGCGTGA
CTGTGTGTGTGAGTGTGTGTGTGTGCATGTGCGAGAGTGTACGAGGAATTTGTTGAGTAG
AAAGGAAAGTATTTCGATACCAAAAAATGTCGCGAAAAAGAGGCACTAGAAACAAGC
TTC
AACTTAAAATACGAAATGTTAAAATTCAACATTATAATTGGTTACTTAAAAAAAACGACA
ACCACCGACAGCAGCAGCAAGAAACTCGGCAGTATTGCGTGTACAACGGCGTTCTACTCT
TGGTTTTGGTGCAAAATATCCTACGGTGCAAACAAAATGGAAACCAAAAAGAACATCATC
ATCCACCCTTAGTTGTCCTCCTGTCGAACGGTTCAATTTTAGTTTAGTTTAGGAATGAAG
TAGGCTTAGTGTTTCGTTCCGGTTTCCTAAATGAATTCACAGCTACAAACGGCTCCCCGT
CATCCTGGCTACGGTTTTGGAACGCGCAACAGCCATCAGCAGAATACGAAATAATCCCCA
CACCGACATTTATTTATTTTCGATTCCGTAGCCGCAAGGATGTGTAATGAATTGAAGGGG
AAAATAAACATGAATACCTACACAACAACAAACCAGGCTACTACTGGTGGTGTCGAGCGT
AAATGAAAGATAAGATATGAGAAAAGGGTTCAGATCGCGAAGAAAGCAATTCGTAACAAA
ACAGAGTACGAACTGTCTTTATGGCAATGAATTGAATTTGAAATAAAATTAGAAATTGAT
TGAGCTTTGATTAAATTAGGGTATATTTCCGCTGCACTCAATTTATACTACCTTTATTTT
AGCATGATTTTCATTTTGTAAACATTTATTGAATTTGTT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004