login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG3283
Organism Drosophila melanogaster
Gene Name SdhB (CG3283)
Product Succinate dehydrogenase [ubiquinone] iron-sulfur protein (DHSB) (By similarity)
GENE MAP
Chromosome 2R
Citogenetic Map 42D3--4
Gene Map
Comment This record is derived from the following: AE003790 LD23740.complete AY118923 gb|L27705|DROSDHB gene             Reference sequence based on BDGP genomic sequence.
PRODUCT
Function Unknown
Subcellular Location Mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex II: Succinate dehydrogenase
EXTERNAL RESOURCES
GO GO:0005739
Cellular component: mitochondrion.
GO:0009060
Biological process: aerobic respiration.
GO:0006099
Biological process: tricarboxylic acid cycle.
SwissProt AC  --
FLYBASE FBgn0014028
View Sequence REFERENCE SEQUENCE
Scaffold AE003790
Sequence Location  --
Sequence Lenght 3660bp
Relative Gene location 1081 .. 2643
P-insertion P{GT1}CG15237-BG00064
P{EPgy2}CG3283-EY12081
CDS
CDS Location 1225 .. 2446
Sequence Lenght 297aa
Translation MLATEARQILSRVGSLVARNQMRAISNGTAQLEQQAQPKEAQEPQIKKFEIYRWNPDNAG
EKPYMQTYEVDLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLAC
ISKIDINTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKNEAGEKKGKAQYL
QSVEDRSKLDGLYECILCACCSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDENSAERL
NKLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLASKPAPKLETAALHK
mRNA
mRNA Location 1081 .. 2643
5'UTR Location 1081..1224
3'UTR Location 2447..2643
Exon 1081..1287,1560..1996,2053..2643
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
CACTCGAAGCCGCCACGGCCACACTGCACCCTCAGTTTCGTGCAACTTTTTGTACGCAAA
TAAGAAAAACATTAAATTTGCTCTCAGCAAATCGATAATTGCAAACGCAGTGCCGTTTCA
ATTGCAGCACAAACCGCAACGAAA
ATGTTGGCGACCGAGGCGAGACAGATCCTGAGCCGC
GTGGGATCCCTGGTGGCCAGGAACCAG
ATGCGCGCCATCAGCAATGGCACCGCCCAGCTG
GAGCAGCAGGCGCAGCCCAAGGAGGCCCAGGAGCCGCAGATCAAGAAGTTCGAGATCTAC
CGCTGGAACCCGGACAACGCCGGCGAGAAGCCGTACATGCAGACCTACGAGGTGGACCTG
CGCGAGTGCGGCCCCATGGTGCTGGACGCGCTGATCAAGATCAAGAACGAGATGGACCCC
ACGCTCACCTTTAGGCGCTCCTGTCGCGAGGGCATCTGCGGCTCCTGCGCCATGAACATC
GGCGGCACCAACACGCTGGCCTGCATCAGCAAGATCGACATCAACACCTCCAAGTCGCTG
AAGGTGTACCCGCTGCCCCATATGTACGTGGTGCGCGACCTGGTCCCGGACATGAACAAC
TTCTACGAGCAGTACCGCAACATCCAGCCCTGGCTGCAGCGCAA
GAACGAAGCGGGCGAG
AAGAAGGGCAAGGCCCAGTACCTGCAGTCCGTCGAGGATCGCTCCAAGTTGGACGGCCTG
TACGAGTGCATCCTGTGCGCCTGCTGCTCCACCTCGTGCCCCTCGTACTGGTGGAACGCC
GAGAAGTACCTGGGCCCCGCCGTGCTGATGCAGGCCTACCGCTGGATCATCGACTCGCGT
GACGAGAACTCCGCCGAGCGTCTGAACAAGTTGAAGGACCCCTTCAGCGTCTACCGGTGC
CACACGATCATGAACTGCACGCGCACCTGCCCCAAGGGGCTCAATCCCGGCCGTGCCATC
GCCGAGATCAAGAAGCTGCTCTCGGGCCTGGCCTCCAAGCCGGCTCCGAAGCTGGAGACG
GCGGCGCTGCACAAGTAG
GGCCCAAGTCCTCTACTCCCAGTTCGTCCCCTGCTGTCCTTA
ACCAGTGAGCTAAGCCTCCGAAAATGTGTATTGGAGACTCCTCCAGCCAACATGCTTACT
ATGTTATAATTTATTTAAGCCTAAAGTATCCGACACTTGTTATTACAGTTTGTAAAGGGA
ACAAGACGCGAAAATAAATAATTGTGTATCCACCA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
ATGAAATCCTTCTTTTCACTTCCCTCGAACGGTTTTATTTAAGTTTCGCGCTCATTGTTT
TTATTTGCTTTTAATAGGCGGACAAGAAGTTGTGGCCGGAATCCAGCCTTCGGTGGCAAC
TTTAGTGGCTGCCAGTGTTTGCTCTAACATTGAAAAAGTTTTTTCCACCGCTTTCTTCGC
AGGCATCGGCTCATAAAACGAACTGCAGACCCACTTGCCTTTCACTTCACCTGGGCTTTC
CATTTCTAGGTGCGAATGACAAAGGGGCGAGGCTGGGCGGTGCGGAAGAGCCCGCAAACT
TTTCCCAACAACAAAAGGTCACTGAACAATTGACAAAGGCGGCGTGCTGCTGTCTCAGGA
CTTGCCAAACGCCATTTAAAAAGTTTTGCATAATAGTTGGCCCACGATCTCGCGAAGTAC
CCGCCAGGGCAGAATTTCTCCAATGCCAGAACAATATAGCCATTAAAATCATAAAAAAAA
AACAAAGACAATGTTATAGTCGAGTTCACCGGCTATCAGATACCCGTTACTCAGTGATAT
TTTTCGGCATATGTATAGAAATCGCAAAGATAATTAGTGAAGTAGGTAAAATCTACCTGT
TTAACTTTTAAGCATTAGCAATAACTCAACGTTCGTGCGGAGCACGGCTAGATATCCTTC
CTAAGGAGACGATTCCTTCTACCTGTATACTTTTTAGAGAATCTAGTACCCTATGAAAAC
CCTCTTACCGTTATAGTATGTTCTAACATCAACTTTACTGACTGGCCATTATTTCACTGA
AATCATTCGATTATTTTTAAGTCTTAGTACCTTATGTTGGGAATATAATCATATTGTGGT
TAAGTTGATTTTTATACAAAGTGATTAGGCACGATTAAGCCAACTCCAACAATGTTTATT
GTTTTAACTTACTTTCGGAAGAAGCTGTAGCATAATAATAATAATTAATTGTTATAATAA
TTTGTTAGTTTTATCAAACAAGTGTTTTCCTAGTTTAAATAGAAATTAAATTCAAAGGTG
CAAATACGTTACAGGCTGTGTGACCAGTGCGCGCATGGTATATTTTAGTGCGTTCCCCAA
CACTCGAAGCCGCCACGGCCACACTGCACCCTCAGTTTCGTGCAACTTTTTGTACGCAAA
TAAGAAAAACATTAAATTTGCTCTCAGCAAATCGATAATTGCAAACGCAGTGCCGTTTCA
ATTGCAGCACAAACCGCAACGAAA
ATGTTGGCGACCGAGGCGAGACAGATCCTGAGCCGC
GTGGGATCCCTGGTGGCCAGGAACCAG
GTGAGTGGAGTGCGCGGTGGCCCAGGGCTCTTC
TGGCCAAGATTTCAGGGGCGTGGTGGGGCGGGGGCGCAGGCGGCTTTTGTGTAGTGCAAT
TATATAAGGTGGAAGTGGGGAAGTAGGGGGTCCGGGATAGAAACGCCACAGATAAGCACG
CGAAATGCACTCCGTAATTGGGGGAACTGCCAACTGGCAGAGGCTGTTATGTAAACCTTT
TTTTCAGCGGCACCTGAATTGGATAAAATGGGTAATGGCGTGATTCTCCGAACTTGCAGA
TGCGCGCCATCAGCAATGGCACCGCCCAGCTGGAGCAGCAGGCGCAGCCCAAGGAGGCCC
AGGAGCCGCAGATCAAGAAGTTCGAGATCTACCGCTGGAACCCGGACAACGCCGGCGAGA
AGCCGTACATGCAGACCTACGAGGTGGACCTGCGCGAGTGCGGCCCCATGGTGCTGGACG
CGCTGATCAAGATCAAGAACGAGATGGACCCCACGCTCACCTTTAGGCGCTCCTGTCGCG
AGGGCATCTGCGGCTCCTGCGCCATGAACATCGGCGGCACCAACACGCTGGCCTGCATCA
GCAAGATCGACATCAACACCTCCAAGTCGCTGAAGGTGTACCCGCTGCCCCATATGTACG
TGGTGCGCGACCTGGTCCCGGACATGAACAACTTCTACGAGCAGTACCGCAACATCCAGC
CCTGGCTGCAGCGCAA
GTGAGTGGGAGCAATCCCTACGAGCTGGAACGTTACTAATACCA
CGCCCTTTGCAGGAACGAAGCGGGCGAGAAGAAGGGCAAGGCCCAGTACCTGCAGTCCGT
CGAGGATCGCTCCAAGTTGGACGGCCTGTACGAGTGCATCCTGTGCGCCTGCTGCTCCAC
CTCGTGCCCCTCGTACTGGTGGAACGCCGAGAAGTACCTGGGCCCCGCCGTGCTGATGCA
GGCCTACCGCTGGATCATCGACTCGCGTGACGAGAACTCCGCCGAGCGTCTGAACAAGTT
GAAGGACCCCTTCAGCGTCTACCGGTGCCACACGATCATGAACTGCACGCGCACCTGCCC
CAAGGGGCTCAATCCCGGCCGTGCCATCGCCGAGATCAAGAAGCTGCTCTCGGGCCTGGC
CTCCAAGCCGGCTCCGAAGCTGGAGACGGCGGCGCTGCACAAGTAG
GGCCCAAGTCCTCT
ACTCCCAGTTCGTCCCCTGCTGTCCTTAACCAGTGAGCTAAGCCTCCGAAAATGTGTATT
GGAGACTCCTCCAGCCAACATGCTTACTATGTTATAATTTATTTAAGCCTAAAGTATCCG
ACACTTGTTATTACAGTTTGTAAAGGGAACAAGACGCGAAAATAAATAATTGTGTATCCA
CCA
GCCGGGCGACATTGTGATGGGCAATCAGGGCACTCCCATTCATTTAGGGGGCTGTGG
GTGAGGTCTCGTCGTTCATCTGAATGTCGTCGGCGGAGTAAAAGTCCTGGGTTACCGGGA
TGACGCGGTCGTTGGTCTCGTCATCCTCCTCATCGTGACTGTCCGTGTCCTCGCTGTCGT
CGTTGGCTGCACAAGGGCAATTGGACGTAAAAACGATAATGGTAATCCGAATGCAGTGTC
CTGCCGTACTCACCATCCTCGTCGTCGGTCTCAATTCCGGGTATGGTGAGCATTTTGCCC
AGCGGCTGCAGATCTGTGCCGGCCGTCTTAAGGGACTCTCGCTGTACGGTTTAAGTTTAT
AACAATTTATACAGAAAGCGGTGTCTGGAGAGAACTCACCCAGTTGCTCCTTTCATCCTC
ATAACGCCGCGTCTGCGATTCTTCGTTTACGGAGGCAGGAGCCATGTCCAACCAGTAGCG
ATTGGCCACGGAGACTTTGAGCGTGGGAAAGAATGGAATCATTGACATTTTCGACGGAAT
CTTGAATGCGCTGTTTTCAATATTTGTTGTTCTTTCTCTGGAAGCCTTTGATGCGATCTG
GCAACGCCGCAACATACGCTGTAAATAATACCAATTTTACAGGGGCGTAGTCGTAGGGGC
GCATTAAACGCAAATTACAATATTAATTGTAATTGTAATTCATCAATCTAACTATGTATT
TTGTTATTGTCAAGGGAAGTCCGATAACCAAGGGCTTAATACAGCTTACTCAAAAATATA
TATCTTCACTATTACAAATTGACCTTAAGAATCAGAACATAACCAAAACGAATAATATAT
ATTATTCAAAATCTTTTTATTTATTAAAGAAGCTATAAAAATTGGACAAACTAGACACAG
GAACGGTATTCCCTTGCAGTTTTATTGGTAGTAAAGTTCCAGATTCATGCCATCGTGAAT
TTCATCTAAGAAAGCGAAAAAGAAATGCGGGTAAAGCAAGGCGTTACAAGGACACTAAAC
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004