login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG13573
Organism Anopheles gambiae str. PEST
Gene Name agEG13573
Product NADH-ubiquinone oxidoreductase SGDH subunit (NISM) (By similarity)
GENE MAP
Chromosome 2L
Celera Gene agCG55156
Citogenetic Map 27D
Gene Map
Comment This record is derived from the following: gb|AAAB01008807.1 gb|BM647524.1 5', mRNA sequence gb|BM636096.1 5', mRNA sequence The following contributed to reference sequence development: bases 1..2756 - AAAB01008807.1 4296178..4298933
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000013573
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008807.1
Sequence Location 4296178..4298933
Sequence Lenght 2756bp
Relative Gene location 1010 .. 1858
CDS
CDS Location 1031 .. 1759
Sequence Lenght 189aa
Translation MAIFSSLARSGQFSARLGALLSNPALLQASKNALTGTRSMSGGHGPKNFTITPSRFQWHK
FKDLFHYYIMVGLIPVGAVVFYANVFVGPATLTETPEDYTPKHWEYHRHPITRFIARYIL
PNPQQEYEKMLHHVYEENEKAQIRALEKEVRAKMAERNDYQSYYYRPAIGKYHRVAKEAA
EQLEALRGD
mRNA
mRNA Location 1010 .. 1858
5'UTR Location 1010..1030
3'UTR Location 1760..1858
Exon 1010..1127,1287..1858
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATCGAAAACATACCAAACAAGATGGCAATTTTCAGCTCGCTGGCTCGTTCCGGCCAATTT
TCGGCCCGCCTGGGTGCTTTACTAAGCAATCCGGCACTGTTGCAGGCAAGCAAAAATG
CC
CTCACCGGTACGCGCTCGATGTCCGGCGGACATGGACCGAAGAACTTTACCATCACGCCC
TCCCGCTTCCAGTGGCACAAGTTCAAGGATCTGTTCCACTACTACATCATGGTCGGGCTG
ATCCCGGTCGGTGCGGTTGTGTTCTACGCGAACGTGTTCGTCGGCCCGGCCACCCTGACC
GAAACGCCGGAAGACTACACGCCAAAGCACTGGGAGTACCATCGGCATCCGATCACGCGC
TTCATCGCGCGGTACATTCTGCCCAACCCGCAGCAGGAGTACGAGAAGATGCTGCACCAC
GTCTACGAGGAGAACGAGAAGGCACAGATCCGGGCGCTCGAGAAGGAGGTGCGCGCGAAG
ATGGCGGAACGTAACGATTACCAGTCGTACTATTACCGCCCGGCCATCGGCAAGTACCAT
CGGGTGGCGAAGGAGGCCGCCGAGCAGCTGGAAGCGCTTCGTGGCGATTAA
AGGGGACGC
CGGAACGACACGACCTATCCCCCCTCCCCCCATAACGATGTAGAATATGTCGTCTAAATA
GATGTAAATGGTGCTCGGCAGCGAAGCGAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GCTGGGGCTGAGAAAACGCCCCAAACGCACACGGAGCGGAAGGAGAACGCGCTTTTCTTC
AAATTCCGTTTCCTCTTCAAACCGAGCGCTTCTTCGTCCGGATGACGCGTTATCTTAATT
GCGTGATAATCACATATTGTGCGTGCACGAACGTATTCTTTGGTCCGTACTTTTCCCCCT
CACTCGCGCGTTCTGTCCCTTGTGTATTTCGCTCTTTTCGCTCCTGGGGGTGGTGGGTTA
GATGGGGTGTTAATAGCGGTCAAACGCCGTTGAAAGGGCGATGTGTGTATGGGGAACCTA
CACAACTGTTCTCTTGTTCACAACTTTGTACTTCACGTAGAATGCGCACTTGAAATTGGG
ATGCACTTTTCTCACTTACTGCACTGAAAATGGGCGGACGAGAGCGAAGACGACGACGGC
GACGACGGTTCACTTTTTGCCTGAGATTATTTCTGTGTGTGAATCAACCAAACAAACCCT
GGAACGCGACAAGCGAGCGAACGAAGGGTGTCTGTTGAGGAGGTAAGTACACCACCCAAC
TGTCAGAAGAAGTAAGGCCGTTCGTTTGACAGTTGCTTGTCGTGATGGTTTGGAAAGATT
GGGTTATTTCGAAACATTTACGGTGATATTATAGTATAATTTACGCATTTCACATGATTG
ACATTCGTCACAATGGTTAAGCTCAACAGGTTTATCGTAACATGGCTAAATAAGCAACAA
ATTCGGTGGATAATCTTCTGTCAAATTAAACCTAATCAAACGAACACTCTCGACGCATGT
CCTTACCTTCATTCCATAACATTTTCAAGTCTTGTAAATAAAACCCTATCCTCAAGCTAC
AACAATTAATTTACCTGCTATTGTGACGTAAAATATTTAAAACAAAAACGTGAAACAAAT
CCAGCAATATTTCTAAATAAAACCAAACCTTTTTTATCTTTCGTCAAGTCATTTGACGAA
AATCTACACCCCGCCTCAAGCAACCTTGGTCAGCTGTCAAACTCTGCCAATCGAAAACAT
ACCAAACAAG
ATGGCAATTTTCAGCTCGCTGGCTCGTTCCGGCCAATTTTCGGCCCGCCT
GGGTGCTTTACTAAGCAATCCGGCACTGTTGCAGGCAAGCAAAAATG
GTAAGTAAGCACT
CTTTGTAGTGTGATAAGGAGTGGGCTTATTATTTCACCTGCAAAACCTGCTAGAAAAGTA
CCTTCCTCACCGATTGTGTGTTATGCAACTTCAAAACAAATGAATGTGCTTCCCGACGTT
CCGTTCGTCTTTTGTTTTTCTTCTAGCCCTCACCGGTACGCGCTCGATGTCCGGCGGACA
TGGACCGAAGAACTTTACCATCACGCCCTCCCGCTTCCAGTGGCACAAGTTCAAGGATCT
GTTCCACTACTACATCATGGTCGGGCTGATCCCGGTCGGTGCGGTTGTGTTCTACGCGAA
CGTGTTCGTCGGCCCGGCCACCCTGACCGAAACGCCGGAAGACTACACGCCAAAGCACTG
GGAGTACCATCGGCATCCGATCACGCGCTTCATCGCGCGGTACATTCTGCCCAACCCGCA
GCAGGAGTACGAGAAGATGCTGCACCACGTCTACGAGGAGAACGAGAAGGCACAGATCCG
GGCGCTCGAGAAGGAGGTGCGCGCGAAGATGGCGGAACGTAACGATTACCAGTCGTACTA
TTACCGCCCGGCCATCGGCAAGTACCATCGGGTGGCGAAGGAGGCCGCCGAGCAGCTGGA
AGCGCTTCGTGGCGATTAA
AGGGGACGCCGGAACGACACGACCTATCCCCCCTCCCCCCA
TAACGATGTAGAATATGTCGTCTAAATAGATGTAAATGGTGCTCGGCAGCGAAGCGAA
TT
ATGGCGTGTGTTTTATTCCTGCACTCAGAATAAGCTTACAAGAAATGAATTACGAACTAA
TACGGTCGGTGTGTTGGGGGGAATGAAGCGTTTCTTTGGGGCGAAATCACGTTCGACAGC
AGCGGCTCCCTGCTCTATCCCCATGCCTGGGTTTTGGCGTAGTGGAGAATCAGTTTTCCG
TTGGTCCCGTAACATTCGTACAGGTTTTTGATGATCTGATCCGGCGAAGGAGCGAAAGTT
TGGTTTATGTAGAGAAACTGCGGTGAAAGAAAACACGAAAAGAATGATTCAATAGTTTAC
AAGACACTTGTAATGGGGGCAAACGTACCAATCGTTCTTCCGCATCCAGCTTTAGATACT
TATGGATAAACTTTACAATAGCGCTGATGGGCTTTTCCTGGTCCACTGCCCATTTCTTCT
GCTTCAAGATCGGTGCACTGCCGGTGGCATGAAGTACAATATCAACTAAAAGAGGGAAAA
CCGGGACAATACTTATCAGTACCACCCCCTTCAGGTGGGATGACGGGGGGAGGGAATCCT
GGGTACATACTTTTCTTTGATTCCTGTTTTTCAACCTTCTGGTTCGTCAGGGAGAGATTT
TCCACATTCGTCGCCAAATCCTTCTCGCTATTGTTGTCAATGCCGGTCGCTTCAGCCTCT
TCTGCCATGGTTTCGTCGCAAATTTGCTCACACAGAAGCTGTTTCACCAAAAAGTGCCTT
CTACTTTGTGCAAAATTCACGAATGTCGGGTTTTGTTTACATTCTGTTGGGTGTTTTTCT
ATGCGCTTCGGTTGTCTGGCAACACTGGCCGGCTGTTTGACAGTAATGACAGGTGTAGAA
CCAAAACAACACCGCAAGAAATAAAACACGTTTGCGACCGCACGTTTTCTGTTTCG
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004