login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG12203
Organism Drosophila melanogaster
Gene Name CG12203
Product NADH-ubiquinone oxidoreductase 18 kDa subunit (NUYM) (By similarity)
GENE MAP
Chromosome X
Celera Gene CG12203
Citogenetic Map 18C7
Gene Map
Comment This record is derived from the following: AE003512 RH17496.complete AY070680 Reference sequence based on BDGP genomic sequence.
PRODUCT
Function Function: Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0005624
Cellular component: membrane fraction.
SwissProt AC  --
FLYBASE FBgn0031021
View Sequence REFERENCE SEQUENCE
Scaffold AE003512
Sequence Location  --
Sequence Lenght 2880bp
Relative Gene location 1036 .. 1946
CDS
CDS Location 1146 .. 1846
Sequence Lenght 183aa
Translation MSALRQVMCRSTASLQLYQANRAAAARWASTATDGGPLDPKTALARPEELEQRNKLSGKI
TVPTAVNLSPISGVPEEHIRERRVRIHIPPKNAMQSGTDNVNTWQIEFDNRERWENPLMG
WASSGDPLSNMNVQFGSPEEAITFCERNGWRWYVDGAAKPKKERVKNYGINFAWNKRTRV
STK
mRNA
mRNA Location 1036 .. 1946
5'UTR Location 1036..1145
3'UTR Location 1847..1946
Exon 1036..1195,1286..1606,1666..1946
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
GGCACTGGCGAACAGCTGTTTTCCCAATCGAAAAGCGCTTGTGTTCCAAATTTTACGTAA
TTCGTATTTTGAAGCCGATTTCTGCCGTGTAGCCCCAAACGCCTAGCGAA
ATGTCGGCCC
TCCGCCAAGTGATGTGCAGAAGCACCGCCTCCCTGCAGCT
GTACCAGGCCAACAGGGCAG
CCGCTGCCCGCTGGGCATCCACCGCCACGGACGGCGGTCCGCTGGACCCCAAGACGGCCC
TGGCCCGCCCCGAAGAGCTGGAGCAGCGCAACAAGCTGAGTGGCAAGATCACCGTGCCGA
CTGCCGTCAATCTCAGCCCGATCAGCGGCGTTCCGGAGGAGCACATTCGGGAGCGCCGTG
TGCGCATCCATATTCCGCCCAAGAACGCAATGCAGAGCGGCACCGATAACGTGAACACCT
GGCAAATCGAGTTCGACAACCGCGAGCGCTGGGAGAATCCGCTCATGGGCTGGGCCTCCA
G
CGGCGACCCATTGTCCAACATGAACGTGCAGTTCGGATCCCCAGAGGAGGCCATCACGT
TCTGCGAACGGAACGGATGGCGCTGGTACGTCGACGGCGCCGCGAAGCCCAAGAAGGAGC
GCGTCAAGAACTACGGCATCAACTTTGCCTGGAACAAGCGCACGCGCGTCTCCACCAAGT
AG
ACGCTCCCCGCAGCTAGCCAGGATTATAGACCACAATTATCTGATTTTTTTTTTGCTT
TGTTCATTATCTGAGTACCCAAATAAACAGTCGGCTGGACTC
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
CAACTCGCCTCGCTGGGCCGCCTTGGCCTCCTGCTGCTCCGCCTCGCGCGCCGTCCGGAA
TCGCCGGCTGCGCTGCTGGTTCATCTTGGCCCGTGGAGCCACCCCGTCAACTGAAAGGAA
GAAGAGGCGCTGCGGCTTGATCAGGTAGAACAGCTTGTCTACGTAGTTGAAGATTTCCTG
GAATATCTGCTCCTCCTCCAGGTGAAAGTGTATGTTGTTGTCGTCCGGATGCGAGCAGTT
GTGGACAATGCCGTTCATGTCCAAGTACAGATTGTCGAACTCGGGTATCTGCAAAGGAAC
CGTACGGTGCATGGCAACATATAACGTGACCTAGCAGCTTTACTTACGCAGTGCTCCCGC
GCCAATTCGCTGAGGCACGGATATCGCTCGCTGATGTAGCGAAAGAACTTGGGAACGCCC
ATGTCGCTGTTCTGGATGGGACTGTTCTGCCGCCGTGCTGTTCTGCCTGGATCAGTGGCA
ATTTAGATGAACTGAAAAATTTGTGTCTTTATCTGTTTTCAACATGTATTGATTGACACA
AAAGTTGCAAGTAGGCGAGGCGTTGCCACAACGTTTCGCTATTGCCATGTGGTAGGGCCG
GCGGCATTCCGCAGTTCGATGAATAACTGAAAGAATAAGGACCCTGACCGATTCAAATCG
ATATTAGAATCGATAAGCGAAACGGGCTCCTTTGCCAATAATCAGCTAATGGTGAAATTA
AGCTAAAAGGAGCTAAGAACACCTACATATCTGGCAGCACTGGGCAAATGCAATGCTCAT
CATTTAAACAGTTGGCTTACAAATAGCATAGTTTTAGTTCTAGTTACTTCTCTAGTTCAT
CATCAGTGTATTTCATTTCATTCATTTTCATTTTAAAGTTCATTTTACCACTTGAACAGC
ATTTCATAGTTTTTGCGAAGTTCGAAGTGAAAAAGAAGAAAACTGTTTTTGAACTATTGT
GGCATCGCATCCAAGGCGAGGGGCCACACTGTTTCCAATTAGAATAAAAACACTCACCGC
TCGCCTGGTCACACTGGCACTGGCGAACAGCTGTTTTCCCAATCGAAAAGCGCTTGTGTT
CCAAATTTTACGTAATTCGTATTTTGAAGCCGATTTCTGCCGTGTAGCCCCAAACGCCTA
GCGAA
ATGTCGGCCCTCCGCCAAGTGATGTGCAGAAGCACCGCCTCCCTGCAGCTGTAGG
TACCCCCGCCTGGCCGGAGCAAGTGCATCCGACCTGGCAAATCTGCAGCCCTCTAATTAT
CCACTTTCGCATCTTGACACCGCAGGTACCAGGCCAACAGGGCAGCCGCTGCCCGCTGGG
CATCCACCGCCACGGACGGCGGTCCGCTGGACCCCAAGACGGCCCTGGCCCGCCCCGAAG
AGCTGGAGCAGCGCAACAAGCTGAGTGGCAAGATCACCGTGCCGACTGCCGTCAATCTCA
GCCCGATCAGCGGCGTTCCGGAGGAGCACATTCGGGAGCGCCGTGTGCGCATCCATATTC
CGCCCAAGAACGCAATGCAGAGCGGCACCGATAACGTGAACACCTGGCAAATCGAGTTCG
ACAACCGCGAGCGCTGGGAGAATCCGCTCATGGGCTGGGCCTCCAG
GTGAGTAGCTGGCA
CGTCCACCATGCCATGGCAACCTTGGTCAACGTCTCGTGTTCCAGCGGCGACCCATTGTC
CAACATGAACGTGCAGTTCGGATCCCCAGAGGAGGCCATCACGTTCTGCGAACGGAACGG
ATGGCGCTGGTACGTCGACGGCGCCGCGAAGCCCAAGAAGGAGCGCGTCAAGAACTACGG
CATCAACTTTGCCTGGAACAAGCGCACGCGCGTCTCCACCAAGTAG
ACGCTCCCCGCAGC
TAGCCAGGATTATAGACCACAATTATCTGATTTTTTTTTTGCTTTGTTCATTATCTGAGT
ACCCAAATAAACAGTCGGCTGGACTC
AAATGACCACAGCACCATGTAATGGCCACCAGTT
TCGCTGCCAATGGAAGCGGCACCATCACATGCCGCTCTAATGACGAGCGGTTTGGGAGCG
ATGCCTATTGTGCTGCTTCTCGCGTGGCTCTCGCTCCTCCCGACGCCTATCGCCATGTCG
ATGCCTGCTCGGACTGCGGCTTCTCTTCCGGCTGTCATCATGATGCTGGTACCAATCTCT
GCGCTCGTTGCGCCAGTCCCGATGCTCTTGTCGCTGTCCTCGGTCCTTGTGCTCCTTAAA
ACGATCCATTTGGTCGTTATGCCGCCCTCTGTCCTCCTGGTACCGCTGCCTGTGCTGCGT
TTGCTCGTTGTGCCGCCATTGGTGCTCCTGAAACCGCTCCGCTGGCTTATCGCGTCGTCC
CTTGTGATCCTGTTGCCGCTCCGTTTGCGTCCTTTGCTGGGATTGCTCAACATACCGTCC
GCGGTGCTCCTGTCGGTCGACTTGCTTATGATGCCGCCCGCCGTGCTCCTGTTCCCACTG
CTTCTCCAGCGCCTGCATCTGCAGGCTGACTAGCTGGTGCAGCTCCTCGTTGAGCGTGGG
CTTGCTCTTGCGGTGGCGCCGATGATTCTTTTGCTGACGCCGGGTTTCGCCCACCACCTC
GGCGAAGGCGGTGTTGTCCTGGAACTGCGGGTGCTTCTTGGTGTGCTTTAGAACGTGCTC
GTAGATGAGCAGCCGCTGACTCGCGTCGAGTCCTGCCTGCAGATCATCAAAGGAGGCAGC
AGGAAGGAGGCGTCGTGCTCTTTCGGTGCCCACAATGCCCTGAATAGTCGAGTCATCGAG
CTGGATGCTAAAGTCGGGATTGTTGCTGCATGACGCCGGCAATGGCAATGGCTCTAACAC
CTCCGATTTAGTTGCGCCGTTTTTGTCCTGTGGTCTGTGGCTACCCGCCCCCATCACCCC
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004