login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG11455
Organism Drosophila melanogaster
Gene Name CG11455
Product NADH-ubiquinone oxidoreductase 15 kDa subunit (NIPM) (By similarity)
GENE MAP
Chromosome 2L
Citogenetic Map 21B1--2
Gene Map
Comment This record is derived from the following: AE003590 >GH23780.complete AY069186. The following contributed to reference sequence development: bases 1..2580 - AE003590 154359..156938
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This is a component of the iron-sulfur (IP) fragment of the enzyme.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
SwissProt AC  --
FLYBASE FBgn0031228
View Sequence REFERENCE SEQUENCE
Scaffold AE003590
Sequence Location 154359..156938
Sequence Lenght 2580bp
Relative Gene location 979 .. 1676
CDS
CDS Location 1214 .. 1592
Sequence Lenght 101aa
Translation MSLTPFLRLPLTDLTGCLINHQTYDKCGKFEMKMMECFEAYGLERGKRECADLISDFQEC
VGMQKQLMRFHAMRNERYKQWLKGERKGQEFFADPPRVDAY
mRNA
mRNA Location 979 .. 1676
5'UTR Location 979..1213
3'UTR Location 1593..1676
Exon 979..1426,1500..1676
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
GATACCCGATATCAGAAATCGATGACAGTCTTGTTTTTGTGCTGGAATTAAGGCAATATA
AGACAATTCCTTGGGTATTGCCAACAATTTAAGGTGTGTGATCAGGATATACTCTACTTA
ACGTTGTAGAGAATACATTGAAATTCTTGGGGGCCAGAGACTGCTAACGGCTTGAAGGCT
TAAACCCCTTGTTTATTGTTACGTCACAGTGTGTGTGCTTCGCTCCACAGACAAA
ATGTC
GCTTACCCCCTTTCTACGCCTGCCCTTAACCGATCTGACCGGGTGCCTAATTAACCACCA
GACCTACGACAAGTGCGGAAAATTCGAGATGAAAATGATGGAGTGCTTCGAGGCCTATGG
CCTGGAGCGTGGAAAACGGGAGTGCGCCGACCTGATCTCCGACTTTCAGGAGTGCGTCGG
CATGCAGAAGCAACTGATGCGCTTCCAT
GCAATGCGAAACGAACGCTACAAGCAGTGGCT
CAAGGGGGAGCGTAAGGGACAAGAATTTTTTGCGGATCCCCCACGCGTTGATGCCTACTA
G
ACGGAGACCCGTTTTTCTTGGTTAGTTTCACATTGTAAAACTGCAAATTGTGTAAAAAT
AAAATGAGAAACAATTCTGGTAAAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TGGCCATTCAAAATCCAGGGAGTATGTGAAAGTTCCCTGCTCAGCTTTCGATATCTGCCA
GCTACACAAATCAATGGTCCCTGCAGGTCTATGGAAGTAAGTTTTATAGATTCCTCTACG
TTAGAGCAGGGTATCTGAAAATATTTCTCATAGGTTTCCGCCTTAACTTTGGAGGGTTGA
TACTGTTTCTCTAGTAAACCTCGCGAAATTTCAATGCGCTTTTGATGCGAGGCCTTGGCG
GGAAAGGCTTCTTTGTTTAATTTGACCAGTTTTTCCACCTCTTCGCCTTCCAGACTGTGC
GTGAGGTCTATATTGATCATCAGACCGTTGGCATCGTAAACCTTGGCCAGCTTTTCACAG
ATTATAGGGTGTAGGATCAGCTTGACAGCCTCTTTTATAGGCACGTCTGGGGGATTGTTT
TCGTCTATAGATGGTCCAAATCTTCTTCGCAAGGCAAACCACATGGCCAGCTGTCTCAAC
TGAAGCGACATCGGTAGACAAATCGCCAGAACGATTTTCTGGCAATCGTATTTCGCGAAA
TCCGATGCCAAAATGCTGCTGAGCAGCTCATTCTGAAAGTCTTTGGAGAATAAACCCAGG
CACGTTGAACACACGCCCAGACGGGCCCTTTTAGATGGTTGACTCCCTTCGGATATAACA
AGCTCTTCGTTTTCCACATTTTCATTTAGTTTTACATCCAACTGGGCATTTAAACGGACA
AGTTAGACATCAATTAGTTGTCAACAAATTCAAATTAAACCGTTCTTACCTTTTGCAAAG
TCTCATTGATGTTTCTATACTCCGCGCCTCTGGCCTTCAGGTAACGCAGCTGGCAAATTT
CGCACACCCCGCACGACCTTAAATATTCCACCAAATCCTGGTTTTTCATAGCTTCTCGTG
TAATTAAAATTATAAACAAAACGTGGAAGCGGTTCGCGCGCTAACCAACACTATCAGCTG
TCGAATCTCGAAAAAAACGATACCCGATATCAGAAATCGATGACAGTCTTGTTTTTGTGC
TGGAATTAAGGCAATATAAGACAATTCCTTGGGTATTGCCAACAATTTAAGGTGTGTGAT
CAGGATATACTCTACTTAACGTTGTAGAGAATACATTGAAATTCTTGGGGGCCAGAGACT
GCTAACGGCTTGAAGGCTTAAACCCCTTGTTTATTGTTACGTCACAGTGTGTGTGCTTCG
CTCCACAGACAAA
ATGTCGCTTACCCCCTTTCTACGCCTGCCCTTAACCGATCTGACCGG
GTGCCTAATTAACCACCAGACCTACGACAAGTGCGGAAAATTCGAGATGAAAATGATGGA
GTGCTTCGAGGCCTATGGCCTGGAGCGTGGAAAACGGGAGTGCGCCGACCTGATCTCCGA
CTTTCAGGAGTGCGTCGGCATGCAGAAGCAACTGATGCGCTTCCAT
GTGAGTTTTTCCGT
AGCTTCATATCCCTAACGATCTGTAATTTTGTCTAAAATGCTAAAAATTCCTCTTTCAGG
CAATGCGAAACGAACGCTACAAGCAGTGGCTCAAGGGGGAGCGTAAGGGACAAGAATTTT
TTGCGGATCCCCCACGCGTTGATGCCTACTAG
ACGGAGACCCGTTTTTCTTGGTTAGTTT
CACATTGTAAAACTGCAAATTGTGTAAAAATAAAATGAGAAACAATTCTGGTAAAA
TGTT
TTTCAGTATTTTTGCCAGAGTTGCCGACTTTCACTTCCTTTGTTCTCACTGAAAGTAGCC
ACATCTATTCAGAAATATCTGAATTAATCGCTAACAGCCATGTCGGTAATATTATATTTC
GAACTCTGGTCACACAGCCATACAGCTTGAGCGGAAGAAAAAAAATTATAAGGCTTCTGT
TTTTACAAACAAAATCTTAATTATGGGTACCAAAAGACCCAATAATAGCGTAATTTTGGC
CCAAGAGGCAAAGCGTAGCAAAAATGATCTGATGGCCTACACAAACAGGGACAAAGCGCT
CCTTGAATCGGTAAGCGTGCTAGCAAGAAGAAGCACTAAGTAAATTTTGATAAACTTTGA
ATATGCTTTTACTATAATTTTTAGGGAGTGAGGCGTACCTCAAACCTGCAGGCGCCCATA
ATGCAATTAGAAGGACATGAGGGAGAGATTTTCACAGCGGAATTCCATCCCGAGGGGGAG
TTATTGCTTTCTTCTGGGTTCGATAGGCAAATCTGTGAGTAAAATTTGGAATAAATGTGT
GATAAAGTCGTATGAATACCAAGCTATCTATGCATTCATACAATAGTGCCGTGTATGAGA
GCCTATATCGTCACATTTTTGGGCGCAAATGAATTTGTAGTTCTTGAACATCTTTGATTA
TAGAAATAGCATGTAAAACAATTAATATGGATTTCAGACATCTGGCAAGTGTACGAAGAC
TGCGAGAATGTGATGGCCATGTCGGGACACAGCGGTGCTGTTATGGAAGCTCACTTTACG
CCGGATGGATCGCACATTTTTACCTGCTCCACTGATAAAACTCTGGCCTTTTGGGACATA
GCCACGGGCCAGCGGCAACGGCGGTTCAAGGGGCATGGCAACTTCGTGAACAGCGTTCAG
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004